SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5051817|Sb02g035930 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5051817|Sb02g035930
Domain Number 1 Region: 543-849
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-81
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 84-198
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.9e-21
Family alpha-D-mannose-specific plant lectins 0.0066
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5051817|Sb02g035930
Domain Number - Region: 380-438
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0165
Family Anti-platelet protein 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5051817|Sb02g035930
Sequence length 879
Sequence
MAHAAVAALALLVFFSAQARRDGAGVYVVDAAAALSQGHSLGAGDKLVSSDGTFELAFFT
PTGAADPSRRYLGVMYAQSNEQTVPWVANRDAPVSAGSSYSATVTDAGELQVLEGERVVW
RTNSATTASSSSSSPANVTLTLLDTGNLQLTAGATVLWQSFDHPADTFLPGMSITLDRTN
RSAVRRTLFTSWRSPGDPGTGDFTLGQDPLGSAQLYIWRTGGENTNSTYWRSGQWANTNF
VGVPWRSLYVYGFKLNGDPYNDSGVMSYVFNTYNSSEYRFMLHSNGTETCYMLLDTGDWE
TVWSQPTIPCQAYNMCGANARCAGGGGGDDGQQAVCTCLTGFEPRNVSEYGNGNWTQGCV
RSSPLACSSDANVSGGGGGDGFADLPGVKLPNFAAWGSTVGDADACKQSCLANCSCGAYS
YSGGTGCLTWGQDLLDIYQFPDGEGYDLQIKVPAYLLDQTGSRRRRWTTVAVAVVIVVVV
LAGCGLLLWKCRRRIKEKLGIVGREKTKTTTQPSLLPLREARQDFSGPKQVDQEEAEGGK
KCELPLFSLEMVAAATGDFSADNKLGEGGFGHVYKGRLPGGEEVAVKRLSRGSGQGLEEF
KNEVILIAKLQHRNLVKLLGCCIQGEEKILVYEYMPNKSLDAFLFDPARRGLLDWKTRFH
IIEGIARGLLYLHRDSRLRVVHRDLKASNILLDRDMNPKISDFGMARIFGGDQNQVNTNR
VVGTLGYMSPEYAMEGLFSVRSDVYSFGILILEIVSGQKNSSFHRMEGSLNIVGHAWQLW
NADRGEQLIDPAILPACPVREALRCVHMALLCVQDHACDRPDISYVVMALGSDSSVLPMP
KPPTFTLQCTSSDRDGIFPERVDESYSACDLTVTMLHGR
Download sequence
Identical sequences C5XAW9
jgi|Sorbi1|5051817|Sb02g035930 XP_002462991.1.57931 4558.Sb02g035930.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]