SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5053463|Sb03g030230 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5053463|Sb03g030230
Domain Number 1 Region: 69-162
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.02e-22
Family Cold shock DNA-binding domain-like 0.00095
Further Details:      
 
Domain Number 2 Region: 157-237
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.28e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00077
Further Details:      
 
Domain Number 3 Region: 10-69
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 4.18e-17
Family ECR1 N-terminal domain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5053463|Sb03g030230
Sequence length 239
Sequence
MESRKPAPSPLVDNYVVPGDVVLDLSEMNNQTIKLGAGLRQECDTIQATSAGKLRLLKPN
KYWIENSQKRYIPSVEDTVLGIVVDTKPDNFLVDIKGPNLAFLPVLAFEGGTRRNIPKFE
IGTLIYARVVKANSIMNPELSCMDASGKAAEFGQLKDGYMFDTSTGMSRMLLSSPTCPVL
EALGKKLSFEIAVGLNGRVWVNAPAASTVILVSNAIMRSESLSGIKQRAMVENLLERLS
Download sequence
Identical sequences C5XFW6
jgi|Sorbi1|5053463|Sb03g030230 XP_002456088.1.57931 4558.Sb03g030230.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]