SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5054559|Sb04g001480 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5054559|Sb04g001480
Domain Number 1 Region: 487-767
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-65
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 71-154,188-219
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.4e-19
Family alpha-D-mannose-specific plant lectins 0.0054
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5054559|Sb04g001480
Domain Number - Region: 348-406
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00011
Family Hairpin loop containing domain 0.08
Further Details:      
 
Domain Number - Region: 186-284
Classification Level Classification E-value
Superfamily CBD9-like 0.0318
Family Glucodextranase, domain C 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5054559|Sb04g001480
Sequence length 772
Sequence
MLKAMILISVLLLAVASLPRAQSQNGSLAVGQSLQVGQTLVSAQAIFVLGFFTNGDNTYL
GIWYNYIKPQTVIWVANRDNPIKGGNGSLTFIQSSLVLLDTRRGSTPVWFTDSLNTNNPQ
AFLLDSGNLIINDTTMSGSTPGRVLWRSFDHPCDTLLSGMRIGYDTSAANNGLLQLVSWK
SESDPSPGDYTISMDPKRLPGLFLFNGTDLKCRTGPWNGQGFNGQPYLKTTNDVAFYMTV
HEGSAYYSFMALNTSVQWRLVLTPDGIAHRWYNSNPNNEWAEYWYWPQSQCDSYAFCGPN
AICSSAVCQCLPEFLPKSPIDWNQRNFAGGCVRSVSPFSCSSANGFSRISLVKVPDTQNA
TLVQVKSLDDCRELCLRNCSCNAYAYALPGEGDCVMWSGDLLDTVQLTLGTNDLYTRISH
NDDPSHTDRQTAIIVSVSVVGGFLLISVLLGFCYRRSQRKHLPLVLELFGTEHERAPGSK
LTAHLEQSLDLDAIRVATNNFAERNSIISTRSKTIYKGTLPNVGDLTIKRVNTEAGLEEL
KNEVKILARLHHPNVIRMMGSCIGNNDNLICYEYMPGGSLDAVLFAEDEKYGVLDWPSRL
CILQGICEGLLYLHEHCRIIHRDIDPSNILLSDDLIPKISDFGLATLLDQGQSEGKAESF
EGTRSYSAPELFHRKSYSAKSDVYSFGVVLLEIVTGCKAASFRREDADDLPTYVRQHWTQ
GTAEQLKDPRMGDAPRGEVSRCIHIGLRCVQDDPDVRPTMPYIRNTLAAIRS
Download sequence
Identical sequences 4558.Sb04g001480.1 jgi|Sorbi1|5054559|Sb04g001480 XP_021315625.1.57931 XP_021315626.1.57931 XP_021315628.1.57931 XP_021315629.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]