SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5056395|Sb05g004040 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5056395|Sb05g004040
Domain Number 1 Region: 412-698
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-69
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 320-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000949
Family EGF-type module 0.0074
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5056395|Sb05g004040
Domain Number - Region: 280-345
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00471
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5056395|Sb05g004040
Sequence length 736
Sequence
MTSHSAAVLAAGLVWLLSAVLVVPWLAAGESSSSSSVADDCQRSCGRVDIPFPFGMGPDH
CMLTRDFRITCEDVGNGVRKAPFLANFTNVEVLNISLEQGQAQVLNPISSYCYNATVQQW
DEWTWDLSSTSYTFSNTANKFTVVGCRALAYIGNTKGNTSAMYQTGCVSMCFQGSMDLNA
CSGMGCCQTGIPKGLKYYHVWFDKRLNTSGIDDGTGGSVDPCSFAVLMDSSNNISSPEFN
DSNNSPSEFNSSRGGKAPVVLDWSIGHDDCKTAVRNNNPAGYACRSINSSCSDATSGRGY
ICKCNQGFEGNPYISDGCKDINECKHPDKYNCSGACTNTIGSYNCRPKEAFPRGALIAAG
ILLVFVVALIAFLSIEVFRNKEKKKRQGFFQQHGGQMLLQIIEKDANNIAFKLYERKDLV
KATRRFHKDNVVGEGTHGTVYKAILGTATTVAVKRCKQIDKSRTDEFVQELVVACRVSHP
NIVRLLGCCLHFEAPMLVYEFVPNGTLRDLLHGSPRRRVVTLPTRLRIAAETAEALAHLH
SPPRPTLHGDVKPDNILLGDGWVAKVSDFGCSTINDNVQVVPKGTLAYLDPEFLQDRQIT
EKTDVYSFGIVLIELLTGKNPLAEEWKKLTVMFQNSMRNGTLGDLLDADIVEEWSMGLIY
EVAKLVSRCIAAPGKTRPDMRQVAKELRGFSDEMPESSEARVALGFEDRSRYSYTATEGE
TTGFSNLSALSTELAR
Download sequence
Identical sequences C5Y5I1
jgi|Sorbi1|5056395|Sb05g004040 4558.Sb05g004040.1 XP_002450344.1.57931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]