SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5059387|Sb08g004550 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5059387|Sb08g004550
Domain Number 1 Region: 428-723
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-74
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 319-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000518
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 3 Region: 162-192,269-356
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000267
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5059387|Sb08g004550
Sequence length 732
Sequence
MVSSVGVLRLLPWLALAAVLLPPPPAASQQPPARGCRQQCGNVTVPYPFGIGAGCHRGAP
TGGFRLQCDDAGAGVGRGHPPRLTVSGYGHEVAAISLATAEATVLLNASRACYDRPGDAD
GCVVSLREQPMALNGSAFLFSSMKSKFVSIGCPGIAYFNDGDGYYVTGCMSVCRPSDRAL
PGSCRGDDGCCQSNIPLGLNSYRPYLGSFGRRRRGRRRDQEATFLANSTACSYAFMVDAM
WFWLAGSHFNRTGDFVVPVVVDWAIRDAPSCAAAARDVGDTYACRSAHSVCLESSNGPGY
ICNCTAGYQGNPYVADGCTDVDECRHGDEFPCYGVCVNTPGSFTCTCPKGSSGNATLQGG
CRRDDDSRFGLPLKIVTGVSAGVLLLLLASFSSHLWVQKRRLLQAKKRFFEQNGGVLLQQ
QLGSLASSGVAFRIFSEEDIGRATDGFAEARVLGRGGHGVVYKGVLADGSAVAVKKSRVV
DGKQVKEFAREMLILSQINHRNVVKLLGCCLDVEVPMLVYEYVSNGSLHGYIHHGGGGGG
EVQLSPGARLRIAAESADALAYMHSSASPPILHRDVKSANILLDGDLAAKVSDFGASRLA
PAGEAAVATLVQGTLGYLDPEYLLTSQLTSKSDVYSFAVVVLELLTGRKAFVPVEDEDGE
EEGGLAFCFITAAQAGRHREIMDQQVMEEVGAEVLDEATELLVRCLSMVADERPTMKEVA
DKLHRISSGTQN
Download sequence
Identical sequences C5YSQ2
XP_002441899.1.57931 jgi|Sorbi1|5059387|Sb08g004550 4558.Sb08g004550.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]