SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sorbi1|5059819|Sb08g021540 from Sorghum bicolor

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sorbi1|5059819|Sb08g021540
Domain Number 1 Region: 420-710
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-73
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 307-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000227
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  jgi|Sorbi1|5059819|Sb08g021540
Domain Number - Region: 274-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00457
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sorbi1|5059819|Sb08g021540
Sequence length 725
Sequence
MKEALVVLLMLIISPVKAAALSSATPSEPALSLPGCPDKCGDVTIPYPFGIGDGCAATSR
NPSFAVTCNNTFQPPRPMIYAPASNTSTPMEVIDISLERGEVSIYAPVGYSCFEPNTNTL
DNYTGEFSLEGTPLILSSTRNRFMAIGCSALGLIGASDPEPSVAGCFSYCEGINQTSDGA
PCSGKGCCETAISPNLTAFQAAVANVTLLPSFNPCIYAMLVQVGWYSFRRQDLVGHLGFV
NERASRGVPVISDWAIRNGSCPKEGRVVPQDYACISTNSYCTNASNGPGYLCSCSKGYKG
NPYLREGCQDINECEMRNQDPKYSALYPCKKGVCINTPGSYVCRCRIGTKSDGRNSGCQP
VLRQSEQVIIGLCVSALVVTSVTCLLVMKLQRRKHMKEKDEYFKQNGGLRLYDEMRSRQV
DTILILTETEIKQATENYSDNRVLGCGGHGTVYRGILDDGKEVAIKKSKVIDDDCREEFV
NEIIILSQINHRNIVKLLGCCLEVDVPMLVYEFISSGTLFEFLHENDQRLSAPLDLRLKI
ATQSAEALAYIHSSTSRTILHGDVKSLNILLDNEYNAKVSDFGASALKPMDKNDFIMLIQ
GTLGYLDPEAFVSHHLTDKSDVYSFGVVLLELITRKRAIYIDNHNEKKSLSHTFILRFHQ
NELQDILDSEIVDNEVMVVLEKLADLIMQCLSSTGDERPTMKEVAERLQMLRRLQMQLVT
KTNPI
Download sequence
Identical sequences XP_002442540.1.57931 jgi|Sorbi1|5059819|Sb08g021540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]