SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000000362 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000000362
Domain Number 1 Region: 236-478
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.95e-57
Family Decarboxylase 0.000000382
Further Details:      
 
Domain Number 2 Region: 6-204
Classification Level Classification E-value
Superfamily PRTase-like 2.29e-43
Family Phosphoribosyltransferases (PRTases) 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000000362   Gene: ENSOCUG00000000412   Transcript: ENSOCUT00000000412
Sequence length 480
Comment pep:known_by_projection chromosome:OryCun2.0:14:94287210:94306953:-1 gene:ENSOCUG00000000412 transcript:ENSOCUT00000000412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASEAALARLVTGLYDVQAFKFGDFVLKSGLSSPVYIDLRGIVSRPRLLSQVADILFQT
AQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGAINLGETCL
IIEDVVTSGSSVLETVEVLQREGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSTML
EILEQQKKIDAEMVGRVKRFIQENVFLTANHNGSPPPVKQAPKELSFGARAELPRAHPVA
AKLFRLMQKKETNLCLSADVSAARELLQLADALGPSICMLKTHVDILNDFTLDVMKELTA
LAKRHEFLIFEDRKFADIGNTVKKQYEGGVFKIASWADLVNAHVVPGSGVVKGLQEVGLP
LHRGCLLIAEMSSAGSLATGNYTKAAVRMAEEHSEFVIGFISGSRVSMKPEFLHLTPGVQ
LEAGGDSLGQQYNSPQEVIGKRGSDIIIVGRGIVAAADYLEAAEMYRKAAWEAYLSRLDA
Download sequence
Identical sequences G1SD91
ENSOCUP00000000362 9986.ENSOCUP00000000362 XP_008264984.1.1745 ENSOCUP00000000362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]