SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000000476 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000000476
Domain Number 1 Region: 147-463
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.29e-127
Family Transglutaminase core 0.00000000761
Further Details:      
 
Domain Number 2 Region: 3-146
Classification Level Classification E-value
Superfamily E set domains 6.3e-41
Family Transglutaminase N-terminal domain 0.00018
Further Details:      
 
Domain Number 3 Region: 618-716
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.99e-26
Family Transglutaminase, two C-terminal domains 0.00033
Further Details:      
 
Domain Number 4 Region: 505-616
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.23e-25
Family Transglutaminase, two C-terminal domains 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000000476   Gene: ENSOCUG00000000551   Transcript: ENSOCUT00000000551
Sequence length 719
Comment pep:known_by_projection chromosome:OryCun2.0:17:29014452:29051769:1 gene:ENSOCUG00000000551 transcript:ENSOCUT00000000551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGLEVALTDLQSSRNNVRHHTEEIAVDRLLVRRGQAFLITLYFRNRGFQPGLDNIIFV
AETGPLPDLAKGTRAVFGLGSRGGPSPWIALLESNGATSLEVSLCAPPVAAVGRYLLKVH
IDAFQGSITAYQLGEFILLFNPWCPEDAVYLDSEPQRQEYVVNDYGFIYQGNKNWIRPCP
WNYGQFEENIVDICLELLDKSLNFQVDPATDCALRGSPVYIGRVVCAMINSNDDNGVLNG
NWSENYTDGLNPAEWTGSVAILKQWHATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVIT
NFDSGHDTDGNLVIDEYYDSTGRILENKKKDSIWNFHVWNECWMARRDLPPGYGGWQLLD
ATPQETSNGLYCCGPASVKAIKEGEVDLKYDTPFAFSMVNADCVSWLVYGGKEQKLHRNT
SAVGSFISTKGVQSDERDDVTENYKYQEGSPEERQVFLKAVQKLKAGKSQGPPGADAPPS
SSTPLSGDSPQSLDIPSLRPGEVAQVSLKFKLLEPPHMGQDINFMLLAINVSPQSKDLKV
NLSAQSLLHDGSPMPPFWQDTAFLTLFPQEVKTYSCIIPYFQYSQYLSTDKLIRISALSE
EKNSLEKILVNKIITLAYPGIMINVLGAAIVNQPLSIQVIFSNPLLEQVANCVLTVEGSG
LFKKQQRVLIGVLKPQHRASITLTTVPFKSGQRQIQANLKSDKFKDIKGYRSVYVDFGL
Download sequence
Identical sequences G1SDI9
ENSOCUP00000000476 XP_008267334.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]