SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000000969 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000000969
Domain Number 1 Region: 190-507
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.13e-122
Family Transglutaminase core 0.0000000000779
Further Details:      
 
Domain Number 2 Region: 38-187
Classification Level Classification E-value
Superfamily E set domains 1.43e-44
Family Transglutaminase N-terminal domain 0.00000344
Further Details:      
 
Domain Number 3 Region: 530-642
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.92e-28
Family Transglutaminase, two C-terminal domains 0.00000275
Further Details:      
 
Domain Number 4 Region: 642-740
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.01e-26
Family Transglutaminase, two C-terminal domains 0.00000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000000969   Gene: ENSOCUG00000001114   Transcript: ENSOCUT00000001116
Sequence length 741
Comment pep:known_by_projection chromosome:OryCun2.0:4:9395743:9497539:1 gene:ENSOCUG00000001114 transcript:ENSOCUT00000001116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGAEKSQDLDSRPPLPPWRKAEMPLGGEKCVHQPGENTTGNHQITAGALEPQSINWQM
TSNRRAHHTDKFSGQNLILRRGQPFDMLLALNRPLGSGESLEFTVSTGPYPSESTGTKAV
FPLSSGTGRGGWSAVLKGSSDNILTITLSSPASAPIGWYTLNMQISSQGTVSSLKLGTFI
LLFNPWLQADDVFLSNHAERQEYVEEDAGIIYVGSTNRIGMVGWNFGQFEEDILNICLSI
LDKSLNFRRDPATDVALRKDPKYVGRVLSAMINSNDDNGVIAGNWSGNYAGGRDPRNWNG
SVEILKEWKKSGYKPVRFGQCWVFAGALNTVLRCLGIPSRVITNFNSAHDTNRNLSVDVY
YDPMGNPLDRGSDSVWNFHVWNEGWFVRTDLGTQYDGWQVLDATPQEKSQGVFQCGPSSV
HAVRDGDVDLDFDMSFVFAEVNADRITWIYDTASNSQKQNSLDTRSIGKYISTKAVGSNS
RVDITDKYKYPEGSSEERRVFQKALGKLKPNAAFSPTSARDLVEEERSPSISGRFKITGV
LAVGKEVSLALLLKNLTREKKTVTVNMTAWTIVYNGTLVHEVWKDSFTVDLDPEAETQHP
VTISYAQYDKYLKSDNMIRTTAICKVPKEAEVVVARDIILDNPTLTLEVLDQAQVQKPVN
VQMLFSNPLDEPVKDCVLMVEGSGLLRGNLKIEVPALRPKERSRVRFEILPTRSGTKQLL
ADFSCNKFPAIKAMLSIDVAE
Download sequence
Identical sequences G1SES6
ENSOCUP00000000969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]