SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000001013 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000001013
Domain Number 1 Region: 231-625,706-711,742-784
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.89e-98
Family FAD-linked reductases, N-terminal domain 0.000000000000614
Further Details:      
 
Domain Number 2 Region: 610-718
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.64e-30
Family L-aminoacid/polyamine oxidase 0.000000845
Further Details:      
 
Domain Number 3 Region: 126-232
Classification Level Classification E-value
Superfamily Homeodomain-like 2.42e-30
Family SWIRM domain 0.00000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000001013   Gene: ENSOCUG00000001164   Transcript: ENSOCUT00000001166
Sequence length 807
Comment pep:known_by_projection chromosome:OryCun2.0:13:130126749:130271864:-1 gene:ENSOCUG00000001164 transcript:ENSOCUT00000001166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRPSPCSKAAQPPGSAGPQAGPTVVPGSATPMETGIAETPEGRRTSRRKRAKVEYREMDE
SLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGQAGGLQDDSSGG
YGDGQASGVEGAAFQSRLPHDRMTSQEAACFPDVISGPQQTQKVFLFIRNRTLQLWLDNP
KIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIG
SGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVV
SKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKP
VSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEA
AEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRD
RQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIK
LNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPE
WKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLA
LVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVA
AGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRI
ADQFLGAMYTLPRQATPGVPAQQSPSM
Download sequence
Identical sequences G1SEW1
ENSOCUP00000001013 ENSOCUP00000001013 9986.ENSOCUP00000001013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]