SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000001250 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000001250
Domain Number 1 Region: 4-554
Classification Level Classification E-value
Superfamily SIS domain 1.14e-231
Family Phosphoglucose isomerase, PGI 7.34e-16
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000001250   Gene: ENSOCUG00000001455   Transcript: ENSOCUT00000001455
Sequence length 558
Comment pep:known chromosome:OryCun2.0:5:4169177:4197347:1 gene:ENSOCUG00000001455 transcript:ENSOCUT00000001455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALTRNPQFQKLQQWHREHGSELNLRHLFDTDKERFNHFSLTLNTNHGHILLDYSKNLV
TEEVMHMLLDLAKSRGVEAARESMFNGEKINSTEDRAVLHVALRNRSNTPIVVDGKDVMP
EVNKVLDKMKAFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSGGPR
VWFVSNIDGTHIAKTLACLNPESSLFIIASKTFTTQETITNAETAKDWFLLSAKDPSTVA
KHFVALSTNTAKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGA
HWMDQHFRTTPLEKNAPVLLAMLGIWYINCFGCETQAVLPYDQYLHRFAAYFQQGDMESN
GKYITKSGARVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGL
HHKILLANFLAQTEALMKGKSTEEARKELQAAGKSPEDLMKLLPHKVFEGNRPTNSIVFT
KLTPFILGALIAMYEHKIFVQGIVWDINSFDQWGVELGKQLAKKIEPELDGSSPVTSHDS
STNGLINFIKQQREAKIQ
Download sequence
Identical sequences G1SFG6
ENSOCUP00000001250 ENSOCUP00000001250 9986.ENSOCUP00000001250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]