SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000001578 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000001578
Domain Number 1 Region: 108-304
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 5.49e-76
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.0000112
Further Details:      
 
Domain Number 2 Region: 385-537
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 2.49e-62
Family C-terminal domain of adenylylcyclase associated protein 0.000000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000001578   Gene: ENSOCUG00000001833   Transcript: ENSOCUT00000001835
Sequence length 539
Comment pep:known_by_projection scaffold:OryCun2.0:GL018711:2492189:2756963:-1 gene:ENSOCUG00000001833 transcript:ENSOCUT00000001835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRIMQPGFAFGVQQLHPALIQR
PFGMGDMQGLMERLEHAVSRLEQLSAESHRPPGDCGEVNGVNGGVAPSVEAFDKLMNGMV
AEFLKNSRILAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQENDVAALLKPISEKIQEI
QTFRERNRGSTMFNHLSAVSESIPALGWIAVSPKPGPYVKEMNDAATFYTNRVLKDYKHS
DLRHVDWVKSYLNIWSELQAYIKEHHTTGLTWSKTGPVASTAATFSVVSSGPGLPPPPPP
PPPPGPPPLFEDEGKKEASSPSRSALFAQLNQGEAITKGLRHVTDDQKTYKNPSLRAQGQ
TKSPTKSHTPSPTSPRSLPAQKHAPVFELEGKKWRVEYQEDRNDLMIPETELKQVAYIFK
CNKSTLQMKGKINSITIDNCNKFGLVFDNVVGIVEVINSKDIRIQVMGRVPTISINKTEG
CHIYLSDDALDCEVVSATSSEMNILVPQDGDYREFPVPEQFKTFWDGSKLVTEPAEIMA
Download sequence
Identical sequences G1SG83
ENSOCUP00000001578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]