SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000001853 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000001853
Domain Number 1 Region: 91-170
Classification Level Classification E-value
Superfamily Ribosomal protein S18 1.96e-23
Family Ribosomal protein S18 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000001853   Gene: ENSOCUG00000002149   Transcript: ENSOCUT00000002148
Sequence length 250
Comment pep:known_by_projection chromosome:OryCun2.0:12:22663230:22668796:1 gene:ENSOCUG00000002149 transcript:ENSOCUT00000002148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVLNTLLWRVPRLSLFRSAYGVQVPFQTLCTKAPPEKDSLPTGPISPYKDEPWKYLD
SEEYQNRYGSRPVWADYRRNHKGGVPPQRTRKTCIRKDKIAGNPCPICRDHKLHVDFRNV
KLLEQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKARDHGLLRYHIPQVEPRDLDFSTS
HGAVSATPPAPTLVSGDPWYPWYSWTQPPERELSRLRRLYQGHLREESGPPPAAPAEAPS
SEGAGSQSAL
Download sequence
Identical sequences G1SGX2
ENSOCUP00000001853 ENSOCUP00000001853 9986.ENSOCUP00000001853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]