SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000001859 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000001859
Domain Number 1 Region: 176-449
Classification Level Classification E-value
Superfamily Caspase-like 5.83e-84
Family Caspase catalytic domain 0.0000000003
Further Details:      
 
Domain Number 2 Region: 32-121
Classification Level Classification E-value
Superfamily DEATH domain 3.44e-21
Family Caspase recruitment domain, CARD 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000001859   Gene: ENSOCUG00000002158   Transcript: ENSOCUT00000002154
Sequence length 451
Comment pep:known_by_projection chromosome:OryCun2.0:7:8794797:8812804:-1 gene:ENSOCUG00000002158 transcript:ENSOCUT00000002154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPSAGSRASLQQKGLLAADRGRRITAVCGMHPDHQETLKKNRVVLAKQLLLSELLEHL
LEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCVALRETKQGHLEDLLLT
TLSGLQHVLPPLSCDYDLSLPFPVCESCSPHKQPRLSTETEERSLDNGDGPPCLQVKPCT
PEFYQTHYQLAYRLQSRPRGLALVLSNVRFTGEKDLEFRSGGDVDHSTLIALFKLLGYNV
HVLHDQTAQEMREKLQNFAQLPAHRVMDSCIVALLSHGVEGGIYGVDGKLLELQEVFRLF
DNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNQAGSPGCEESDAGKEPLKMRLPTR
SDMICGYACLKGTAAMRNTKRGSWYIEALTQVFAERACDMHVADMLVKVNALIKEREGYA
PGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT
Download sequence
Identical sequences G1SGX8
XP_002711998.1.1745 ENSOCUP00000001859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]