SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000002102 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000002102
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Globin-like 1.57e-44
Family Globins 0.00000612
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000002102   Gene: ENSOCUG00000002435   Transcript: ENSOCUT00000002432
Sequence length 142
Comment pep:known scaffold:OryCun2.0:GL019146:131502:132109:1 gene:ENSOCUG00000002435 transcript:ENSOCUT00000002432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSAAERALLRALWKKLGSNVGVYATEALERTLEAFPRTKIYFSHMDLSPGSAQVRAHG
RKVADALTLAADHLDDLPGALSALSDLHVRTLRVDPHHFGLLGHCLLVTLARHYPGDFGP
AMHASVDKFLHHVISALTSKYR
Download sequence
Identical sequences A0A1Z5LG63 B8K133
ENSOCUP00000002102 NP_001164887.1.1745 9986.ENSOCUP00000002102 ENSOCUP00000002102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]