SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000002427 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000002427
Domain Number 1 Region: 3-220
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.94e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0078
Further Details:      
 
Domain Number 2 Region: 310-484
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000372
Family FAD/NAD-linked reductases, N-terminal and central domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000002427   Gene: ENSOCUG00000002795   Transcript: ENSOCUT00000002796
Sequence length 515
Comment pep:known chromosome:OryCun2.0:13:23534600:23560296:1 gene:ENSOCUG00000002795 transcript:ENSOCUT00000002796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKVAVIGAGVSGLTSIKCCLDEDLEPTCFERSNDIGGLWKYTETSKDGMTRIYWSLVT
NVCKEMSCYSDFPFQEDYPNFMSHSKFWNYLQEFAEHFDLLKYIQFKTTVCSVTKRPDFS
KTGQWDVVTETEGKQHRAVFDAVMVCTGKFLNPRLPLESFPGILKFRGQILHCQEYKIPE
GFRGQRVLVIGLGNSGGDVAVELSRVAAQVLLSTRTGTWVISRSSNGGYPFNMMITRRCL
NVIEQVLPSCFLRWINERQMNKRFNHENYGLSITKGKNPKFIVNDELPTCILCGTVTVKT
SVKEFTETSAIFEDGTVEENIDSVIFTTGYVFSFPFLEEPLRSLCMKKMFLYKHVFPSNL
ERASMAIIGLISLKGSILTGTELQARWATRVFKGLCKIPPPQQLMAEVTKKEELIKRGVI
KDTSEEKLSYIPYMDDLAACIGTKPNIPLLFLKDPRLAWEVFFGPCTPYQYRLMGPGKWD
GARNAILTQWDRTLKPLKTRTVSSDSSKSASLSHY
Download sequence
Identical sequences G1SIC2
XP_017200987.1.1745 ENSOCUP00000002427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]