SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000002748 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000002748
Domain Number 1 Region: 304-460
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.35e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000882
Further Details:      
 
Domain Number 2 Region: 86-195
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-26
Family Spermadhesin, CUB domain 0.0007
Further Details:      
 
Domain Number 3 Region: 199-296
Classification Level Classification E-value
Superfamily LCCL domain 3.01e-24
Family LCCL domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000002748   Gene: ENSOCUG00000003157   Transcript: ENSOCUT00000003162
Sequence length 753
Comment pep:known_by_projection chromosome:OryCun2.0:12:106423325:106501906:1 gene:ENSOCUG00000003157 transcript:ENSOCUT00000003162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFGAGQPLRPIPAQRSAAEQAARSGQQRRRTRRGETEPAKLASGGAMVPGARGALLPRT
AGPSLLALLLAVSAPLRLQAEELGDGCGHIVTYQDSGTMTSKNYPGTYPNNTVCEKTIRV
PEGKRLILRLGDLDIESKTCASDYLLFTSSSDKYGPYCGTMTVPKELLLNTSEVTVRFAS
GSHISGRGFLLTYTSSDHPDLITCLERANHYLKTEYSKFCPPGCRDIAGDISGNMVDGYR
DTSLLCKAAIHAGIIADELGGQISVLQRKGISRYEGILANGVLSRGGSLSDKRILFTSNA
CSRSLSLEPDRQIRASSSWQWANEVGEQVHWSPGQARLQDQGPSWASGDSNSNHKQREWL
EIDLGEKKKITGIRTTGSTQSNFNFYVKSFVINFKNNNSKWRTYKGIVNNEEKVFQGNSN
FRDPVRNNFIPPIVARYVRVVPQTWHKRIALKVELIGCQITQGNDSLAWPRTSPNTDISK
RMSGSITWLPMEQDQKRGGNVTTVAVPLVLLVVLLLVGLGIFAAFRNIRRKKKGNPYGST
DTQKPGCWKQIKYPFARHQSTEFTISYDNEKELTQKLDLITSDMADYQQPLMIGTGTVTR
KGSTFRPMDPEAHELGASSEPGGHYDCPHRTGRHEYALPLTHREPEYATPIVERHLLRTH
TFSAQDGYHVPGPRPAHKHSLSAGGFSPAAGAGAESPAPADRGYDKPKANSVFAPQSGDP
APQEPRLSPGANDGYSAPRDCLQPLQHTASPAL
Download sequence
Identical sequences G1SJ55
ENSOCUP00000002748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]