SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000002908 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000002908
Domain Number 1 Region: 46-96
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000179
Family CUE domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000002908   Gene: ENSOCUG00000003354   Transcript: ENSOCUT00000003353
Sequence length 389
Comment pep:known_by_projection chromosome:OryCun2.0:19:30313366:30329744:1 gene:ENSOCUG00000003354 transcript:ENSOCUT00000003353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLFRRSSSGGGGGGGGGGGARGGGGGSAAAAAPQELNNSRPARQVRRLEFNQAMDDFK
TMFPNMDYDIIECVLRANSGAVDATIDQLLQMNLEGCGGGTCEDSSDSEDSIPPEVLERT
LEPDSSDEEPPPVYSPPAYHMHMFDPPYPLAPPTPPPRTDVLGSGPPSSQRRYRNWNPPL
LGSLPDDFLRILPQQLDSGQGNPAGPKPVSGEGGPAPAPGPDPRDQESRWKQYLEDERIA
LFLQNEEFMKELQRNRDFLLALERDRLKYESQRSKSSSVAAGGDFGFPSSVPGNSDANPA
VSKDALFRDKLKHMGKSTRRKLFELARAFSEKTKMRKSKRKHLLKHQSLGAAASTANLLD
DVEGHCCDEDFRGRRQEAPKVEELLREAQ
Download sequence
Identical sequences G1SJJ0
ENSOCUP00000002908 ENSOCUP00000016971 XP_017204588.1.1745 XP_017204589.1.1745 9986.ENSOCUP00000002908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]