SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000002954 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000002954
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 1.83e-50
Family Thiamin pyrophosphokinase, catalytic domain 0.000000242
Further Details:      
 
Domain Number 2 Region: 146-228
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 4.45e-27
Family Thiamin pyrophosphokinase, substrate-binding domain 0.00000901
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000002954   Gene: ENSOCUG00000003406   Transcript: ENSOCUT00000003405
Sequence length 229
Comment pep:known_by_projection chromosome:OryCun2.0:7:7331030:7796089:1 gene:ENSOCUG00000003406 transcript:ENSOCUT00000003405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNLKYCLVILNQPLDRYFRQLWNKALLRACADGGANRLYDVTEGERESFLPEFISGDFDS
IRPEVREYYNVKGCELISTPDQDHTDFTKCLKVLQKKIKEKDLQVDVIVTLGGLAGRFDQ
TMASVNTLFQTTHITPLPTIIIQEESLICLLQPGKNKLCVDTGMEGDWCGLIPVGQPCNR
VTTTGLKWNLKNDVLSFGTLISACNTYDGSGVVTVETDQPLLWTMAIKH
Download sequence
Identical sequences G1SJN1
ENSOCUP00000002954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]