SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000003563 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000003563
Domain Number 1 Region: 23-198
Classification Level Classification E-value
Superfamily Lysozyme-like 2.18e-26
Family G-type lysozyme 0.00000524
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000003563   Gene: ENSOCUG00000004116   Transcript: ENSOCUT00000004115
Sequence length 198
Comment pep:known_by_projection chromosome:OryCun2.0:2:92990202:92994384:1 gene:ENSOCUG00000004116 transcript:ENSOCUT00000004115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTSRASSPFLHSINPHLHPRLYHGCYGDIMTMETSGALCNIKSLLHCGIRGSEMFAEMDL
RTLKPYQTLIKEVGQRHCVDPALVAAIISRESHGGAVLQNGWDHRGLKFGLMQLDKQICH
PIGAWDSKEHLLQGVEILADRIKAIQKKFPTWNMVQHLKGGLSAFKSGIEGIDTPADIDD
DYVDDVIARAKFYRHHGY
Download sequence
Identical sequences G1SL39
ENSOCUP00000003563 ENSOCUP00000003563 9986.ENSOCUP00000003563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]