SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000003734 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000003734
Domain Number 1 Region: 430-648
Classification Level Classification E-value
Superfamily TPR-like 2.31e-32
Family Tetratricopeptide repeat (TPR) 0.0021
Further Details:      
 
Domain Number 2 Region: 663-804
Classification Level Classification E-value
Superfamily TPR-like 3.47e-22
Family Tetratricopeptide repeat (TPR) 0.0093
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000003734
Domain Number - Region: 182-252
Classification Level Classification E-value
Superfamily SIS domain 0.0645
Family mono-SIS domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000003734   Gene: ENSOCUG00000004320   Transcript: ENSOCUT00000004320
Sequence length 919
Comment pep:known_by_projection chromosome:OryCun2.0:4:67196606:67242352:1 gene:ENSOCUG00000004320 transcript:ENSOCUT00000004320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNMADINLKEITLIVGVVTACYWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFW
GTPMSEERSHKSYRPLTVLTFRLNYLFSELKPMSYHLLNMIFHAMVSVIFLKVCKLFLDN
RSSVVAALLFTVHPIHTEAVTGVVGRAELLSSIFFLAAFLSYTKSKGPDNSIVWTPIALT
VFLVAVATLCKEQGITVVGICCVYEVFVAQGYTLPLLCTTAGQFIRGKGSIPFSMLQTLI
KLIVLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLLNP
SELCCDWTMGTIPLIESFLDIRNLATFIFFCLLGTLGVFSLRYPGDSSKTVLMALSLMAL
PFIPASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQKISNKSVFKKLSWVCLSMVIFTH
ALKTLHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFERALKYFLQATHVQP
DDIGAHMNVGRTYKNLNRTKEAEESYMMAKSLMPQIIPGKKYAARIAPNHLNVYINLANL
IRANESRLEEADQLYRQAISMRPDFKQAYVSRGELLLKMNKPLKAKEAYLKALELDRNNA
DLWYNLAIVYIELKEPNEALKNFNHALELNPKHKLALFNSAILMQESGEVKLRPEARKRL
LSYINEEPQDANGYFNLGMLAMDDKKDSEAEIWMKKAIKLQADFRSALFNLALLYSQTAK
ELQALPILEELLRYYPDHIKGLILKGDILMNQKKDILGAKKCFEKILEMDPGNVQGKHNL
CVVYFEEKDLLKAEKCLVETLALAPHEEYIQRHLSIVRDKISSSSFIEQPVSPAGKMSGV
EEGNKIPPENVKEISSESRPTQIKKSNDNKSQSKSDKQLGKNADKETPQKTTKDIKEIEK
KRVAALKRLEEIERILNGE
Download sequence
Identical sequences G1SLJ6
ENSOCUP00000003734 XP_002711424.2.1745 XP_008255094.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]