SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004122 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004122
Domain Number 1 Region: 4-93
Classification Level Classification E-value
Superfamily DEATH domain 2.73e-18
Family Caspase recruitment domain, CARD 0.0065
Further Details:      
 
Domain Number 2 Region: 1217-1280
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000389
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 1272-1328
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000324
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 4 Region: 1145-1191
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000379
Family TSP-1 type 1 repeat 0.00062
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000004122
Domain Number - Region: 739-765
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00324
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number - Region: 1097-1135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.072
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004122   Gene: ENSOCUG00000005374   Transcript: ENSOCUT00000004767
Sequence length 1489
Comment pep:known_by_projection chromosome:OryCun2.0:11:61728371:61865518:1 gene:ENSOCUG00000005374 transcript:ENSOCUT00000004767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTESVPSEIIEKERKTLLEILQQDPDSILDMLTSRRLISEEEFETLENVTDPLKKSRKL
LILVQKKGEVSCQHFLQCLFSTFPESAAVWCLSRECLMHENNAPPQSMGVPKKPKNDAFA
LGKKQPGNPENTLSFKEKELLDLETSGIFRNKKTTCKETVLSSSENKKENNALKVSLPNS
VEEVEYKVPATITYLKDGQRYEEPDDSLYLGEEEYLEIVGYPKDAEPTVEERDFEDPGHV
VYDVEGNSEYSEAVVFSDEKQSGEDSETSISLEEEEESMEERKKVFKDVLSHLNMDRSRK
LLPEFVNQFSLDRGHRWTPETPGDLAWNFLVKVQALDVTARDSFLRHRILDEDNKEGSLT
GVEKLETQDVQIINPLDVICASMLCADSSLQREVMSNMYQCQFALPLLLPDAENNKSILM
LAAMKGIVKKQSTQSSGGPVGDTEKSLTRMKLPVISFVRLGHCSFSKSRILNRLLSPAQL
EPRKIFLHQDLPVPVLPRQISDGLVEITWCFSGNVDLKETSNVFQRPVAVANLRGDLESF
WTQFGFLVEISSAMFFFTDCLGEKEWNLLMFLGDAAIKRCYFMLSPQAKENEEAQVFQRI
LKLKSSQLLFWEGEEGGDRRKSMKGLQAALQEVMSSSLRSVSVEDMASLARELGIQVDQD
FENTQGIHVSPSENVAGITEGDDQQILSQPKSLSGSQTKMPVSKPGARYEVSQNHQNFHH
TPVFMPPGRNSQPLSTGTGGQCISKSLVCNGDSDCEEDSADEDRCEDSGSRPSCDIDMAP
PNIELTGNGYDALTGQFRNRVINTKSFGGQCRKVFSGDGKHFYRLSGNILSYTFQVKVNN
DFNYEFYDSSWSYVKHTSTEHTSSSSSSFLFSSSSSSVHSHTSHNNEIHKKKSYQLMVVQ
NTVEVAQFINNNPEFLHLAEPFWKELSHLPSLYEYSAYRRLIDLYGTHYLQSGSLGGEYR
VLFYLDSEKVKQSGFSSVDQKKCTSSKFQFLFTSSEHACKDLENALKSAAGTQNNVLQGD
PYVRGGDSGFIAGLSFLELDNPAGNKRRYSKWAQSVPRVPQVIKQKLTPLYELVKEVPCA
SVKRLYLKRALEEYLDEFDPCHCQPCQNGGMATVVGTQCQCHCKPYTFGAACEHGVLVGD
QAGGIDGGWSCWSSWGSCVQGKKTRRRECNNPPPSRGGKSCIGEATESRQCEDEELEHLR
LLEPHCFPLSLVPKEFCPSPPALKDGFVQDEGTIFPVGKNIVYTCNEGYSLMGDPVARCG
EDLQWLVGKMHCQKIACVLPVLENNVQSQPHKPFYAVGEKVTFSCPGGMFLQGPSTFLCG
SSLKWNPEMKNVQCVQKDAPLTQAVPECQRWEKLQNSRCVCKMPYECGSSLDVCARDERS
KRTLALTVCKLHVLRCQGRNYTLTGMDSCAVPAAVQKACGACPLWGKCDAQSSKCVCREA
MECEEEGFSICVELNGKEQTMSECEAGALRCKGQSLSITSINPCAGETQ
Download sequence
Identical sequences G1SMH2
ENSOCUP00000004122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]