SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004432 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004432
Domain Number 1 Region: 448-577
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000113
Family Nucleotide and nucleoside kinases 0.012
Further Details:      
 
Domain Number 2 Region: 46-95
Classification Level Classification E-value
Superfamily UBA-like 0.00000000935
Family CUE domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004432   Gene: ENSOCUG00000005111   Transcript: ENSOCUT00000005119
Sequence length 1298
Comment pep:known_by_projection chromosome:OryCun2.0:2:29323989:29377878:1 gene:ENSOCUG00000005111 transcript:ENSOCUT00000005119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRKRRNLGGNPFRKTANPKEVVVSGVASHEEPTTALPSICETKIDQEELFTSMSEMFSD
LDPDVVYLMLSECDFKVENAMDCLLELSATDAKIEESTSQSFVVPENQVSAAGSGIMEKY
PLEEESEDSKMDSFLDMQLTEDLDSLIQNAFEKLNSSSDDQLYSFLPLQDVNSLNGPREF
INSDSNNMTPIPSTQNVDSDRENLENSASTLSSNTLTSHMALNEPKSFTKDSILALEDNY
PEDSVLNSSLNLASDSIVDCSTLNQRQNELLESECVETQFCQTLLESDANELKAPLNLPV
QNPGLDIPGTGGDQKPTSVSDVFVSPEGFNFKPHKHTELPPKGKDVNYCPVLTPLPLLLP
PPPPPPMWNPMIPAFDLFQGNHGFVAPVVTTAAHWRPVNYTFPPSIISHPSPTKIWRNKE
GTSAYQVQETPVSQTVRKKTTSYVGLVLVLLRGLPGSGKSYLARTLQEDNPNGVILSTDD
YFYINGQYQFDVKYLGEAHEWNQNRAKEAFEKKVSPVIIDNTNLQAWEMKPYVAMSQKHK
YKVLFREPDTWWKFKPKELARRNIHGVSKEKITRMLEHYQRFVSVPIIMSSLAPEKIERI
ELCAYSCEDGIPSSRISDDTTSDKEENVLSSPLRHLELIEHKTLEVTKGTTLPEDVPHLL
SADLNREGKEISAMNTQGAFIQETSHMHCSASESKLGTTDKSENEEQVETMSEKECSTTD
VDSSIERVSSNSCYDESNQEDCDPANTVPLQNEKSSPDEILEERATVKKKAFAKQKSKST
LEKFPRQELPNFVGDWPVDKTMGQRTKRNRKTEKASYVQSDRKFSRPQSRKVSDSSVSVN
TDPTQQGGSSHECTGDGRKSQCDDASESFHSCKYETYQNTESNSFNVVGDWPSPESLAQR
EHRSRMPRSGLNELNPDFGTNDDVNEISLYTAREACWETSPELKTFGSCTLGSSEMLPSE
VSCETQTCGEHSLPFTFTSSASALPAVVGPQTVAEFSEGMPKGVPGIEVGVCTQTEPQDF
ALLWKIEKNKIGVSDSIKVLTGRLDGFKPKTFNINTKADVQETIPYRVMYDKSTYVEESE
LTSADESENLNILCKLFGSFSLEALKDLYERCNKDIIWATSLLLDSETKLCEDTEFENFQ
KSCDESQIGPFSLGLNLKEIISQRGAEEDSNSSAPEFSHGVGVSNTNTQSPGDAERENSE
QAEISTTTPEKPGLAMGMFPSAAVDAKSNDEILPNSQVELPSLYNFKPSLPAVLKAASSE
DVSETDNSLVATETGENVHSSLNLSDILNSISNTSNLE
Download sequence
Identical sequences G1SN86
ENSOCUP00000004432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]