SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004587 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004587
Domain Number 1 Region: 549-607
Classification Level Classification E-value
Superfamily UBA-like 1.28e-19
Family CUE domain 0.0000918
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000004587
Domain Number - Region: 172-210,253-289,380-453,682-750
Classification Level Classification E-value
Superfamily ARM repeat 0.0595
Family Armadillo repeat 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004587   Gene: ENSOCUG00000005290   Transcript: ENSOCUT00000005290
Sequence length 836
Comment pep:known_by_projection scaffold:OryCun2.0:GL018723:2962206:3006728:-1 gene:ENSOCUG00000005290 transcript:ENSOCUT00000005290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALPLDQLQLTHQDPKTGKPRTSPALHPEQKADRYFVLYKPPPKDNIPALVEEYLERAT
FVANDLDWLLALPHDKFWCQVIFDETLQKCLDSYLRYVPRKFDEWVAPTPEVVDMERHLH
RSVFLTFLRMSTHKESKDHFISPSAFGEILYNNFLFDIPKILDLCVLFGKGNSPLLQKMI
GNIFTQQPSYYNDLDETMPTILQVFSNILQHCGLQGEGASTTPQKLEERGRLTPSDMPLL
PPRLHCPIAVRLRKELKDIVLYLCDTCTTLWAFLDIFPLACQTFQKHDFCYRSCQVTLHR
GCSNLPSHQQCILATTEHFWARLPSLSSSGTMPSKACLFWPGCPLLCIAPQWSRRCQKHT
DRLASFYEVAIPEMESAIKKRRLEDSRLLGDLWQRLSHSKKKLMEIFHTILNQICLLPIL
ESSCDNIQGFIEEFLQIFSSLLQEKRFLRDYDALFPVAEDISLLQQASSVLDETRTAYIL
QAVESAWEGVDRRKATDTKDPSVAEDLNGDSHGVSVTAEPISERPSYPENSEEEECLGAA
AALAPAVSGVELDSLVSQVKDLLPDLGEGFILACLEHYHYDPEQVINNILEQRLAPALSQ
LDRSLDRQVKPDPTPLLTSRHNVFQNDEFDVFSRDSVDLSRVHKGRRKQENTRSLVNDKR
AVAAQRRRYEQYSVVVEEVPLQPGDYQGDDYEDEYDDTYDGNQVGANDADSDDELISRRP
FTTPQVLRTRVPGEGQEEDDEDDEEEAENEAPKPDHFVQDPAVLREKAEARRMAFLARKG
YRHDSSAAVAGSPRGHGQSRETTQERRKKEANKATRANHNRRTMADRKRSKGMIPS
Download sequence
Identical sequences G1SNL7
ENSOCUP00000004587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]