SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000005723 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000005723
Domain Number 1 Region: 51-291
Classification Level Classification E-value
Superfamily Caspase-like 5.68e-94
Family Caspase catalytic domain 0.000000000874
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000005723   Gene: ENSOCUG00000006627   Transcript: ENSOCUT00000006624
Sequence length 292
Comment pep:known chromosome:OryCun2.0:2:61899449:61924243:-1 gene:ENSOCUG00000006627 transcript:ENSOCUT00000006624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQDFHKTSGNRSIMENIEENSVDAKSIKNLETKIIHGSKSMDSGISLDNSYKMDYPEMG
LCIIINNKNFHKNTGMSSRSGTDVDAANLRETFMNLKYEVRNKNDLTREEIMELMYNVSK
EDHSKRSSFICVILSHGDEGVIYGTNGPIELKKLTSFFRGDYCRSLTGKPKLFIIQACRG
TELDSGIETDSGVDYDMACQKIPVEADFLYAYSTAPGYYSWRNSKEGSWFIQSLCAMLKE
YAHKLEFMHILTRVNRKVATEFESSSLDATFHAKKQIPCIVSMLTKELYFYH
Download sequence
Identical sequences G1SRD0
ENSOCUP00000005723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]