SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000005973 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000005973
Domain Number 1 Region: 52-285
Classification Level Classification E-value
Superfamily SET domain 1.59e-49
Family RuBisCo LSMT catalytic domain 0.0042
Further Details:      
 
Domain Number 2 Region: 279-453
Classification Level Classification E-value
Superfamily RuBisCo LSMT C-terminal, substrate-binding domain 0.0000000000000327
Family RuBisCo LSMT C-terminal, substrate-binding domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000005973   Gene: ENSOCUG00000006903   Transcript: ENSOCUT00000006907
Sequence length 456
Comment pep:known_by_projection chromosome:OryCun2.0:5:14388465:14391123:1 gene:ENSOCUG00000006903 transcript:ENSOCUT00000006907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGWCQAKWGLQVGLELSPKVSEGRVERWRRRGGPRGRLPCPSPAQVAVSRQGTVAGYGMV
ARESVQRGELLFAVPRAAILSQHTCSIGDLLERERGALQSQSGWVPLLLALLHELQAPAS
PWSPYFALWPELGRLEHPMFWPEEERRRLLQGTGVPEAVEKDLASIRSEYYSIVLPFMEA
HPDLFSPKVHSLELYHQLVALVMAYSFQEPLEEEEDEKEPNSPLMVPAADILNHLANHNA
NLEYSADYLRMVATQPIPKGHEIFNTYGQMANWQLIHMYGFVEPYPDNTDDTADIQMVTV
REAALQKAKVEAERLLLYERWDFLCKLEMVGEEGAFVIGREEVLTEEELTTTLKVLCMAA
EEFREFKDQDGWGDDKREEEGSLTLKNIPKLKAPWKQLLRDSVLLTLQTYTTDLKSEQDL
LSNKEVYTKLSWREQQALQVRYGQKMILHQLLEMTL
Download sequence
Identical sequences G1SRZ1
ENSOCUP00000005973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]