SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006211 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006211
Domain Number 1 Region: 1-122
Classification Level Classification E-value
Superfamily Globin-like 1.81e-28
Family Globins 0.00000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006211   Gene: ENSOCUG00000007190   Transcript: ENSOCUT00000007189
Sequence length 143
Comment pep:known_by_projection scaffold:OryCun2.0:GL018843:229410:232320:1 gene:ENSOCUG00000007190 transcript:ENSOCUT00000007189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFFVNFPSAKQYFSQIKHMEEPLEMERSPQRRKHAIRIIGALNKMVENQHDPDKVSSEES
LVSKAHALKHKVEPVYFKILSGVILEVIAEEFANDFPPETQRAWAKLRGLIYSHVTAAYK
EAGWVQQVPNASTPPATLPSSGP
Download sequence
Identical sequences G1SSI4
ENSOCUP00000006211 9986.ENSOCUP00000006211 ENSOCUP00000006211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]