SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006490 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006490
Domain Number 1 Region: 108-370
Classification Level Classification E-value
Superfamily Caspase-like 4.64e-79
Family Caspase catalytic domain 0.0000000852
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000006490
Domain Number - Region: 17-81
Classification Level Classification E-value
Superfamily DEATH domain 0.00518
Family Caspase recruitment domain, CARD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006490   Gene: ENSOCUG00000007503   Transcript: ENSOCUT00000007502
Sequence length 371
Comment pep:novel chromosome:OryCun2.0:1:111587532:111601272:1 gene:ENSOCUG00000007503 transcript:ENSOCUT00000007502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEYKDVLKEMESAGKAIAGSFMDNLVKKKVIKLEKAKREKFYDAKTHKKAQILVDSLRE
KCHEEDQKLTETFLNIDQNSTGMQEIKAGPEDSAESTDVLKLCPSEKFLRLCKERAGEIY
PIKDKKDRTRLALIICNIEFQHLPLRNGAQFDISGMKRLLEDLGYSVVVKVKLTAKAMES
VLQEFAARPEHNSSDSTFVVLMSHGILDGICGIMHSDKTQDVLPYDTVFRTLNNRNCISL
RDKPKVIIVQACRGANHGEVWFSDSPMALANSSSQLPENLQDDGIYKTHVEKDFIAFCSS
TPHNLSWRDITKGSLFITQLISCFQKYSWCCHLEEVFRKVQQSFEKPSVKAQMPTIERLS
MTRYFFLFPGN
Download sequence
Identical sequences G1ST71
ENSOCUP00000006490 XP_008260284.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]