SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006661 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006661
Domain Number 1 Region: 10-180,282-386
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.61e-49
Family FAD-linked reductases, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006661   Gene: ENSOCUG00000007699   Transcript: ENSOCUT00000007703
Sequence length 477
Comment pep:known_by_projection chromosome:OryCun2.0:16:31476827:31520348:1 gene:ENSOCUG00000007699 transcript:ENSOCUT00000007703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSDCHRKKVAVIGGGLVGSLNACFLAKRNFQVDVYEAREDIRVAKFARGRSINLALSY
RGRQALKAIGLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSISRENLNKDLLN
AVEKYSNAKVHFGHRLLKCNPEEGTITVLGPDNVPKDVTCDLTVGCDGAYSTVRTHLMKK
PRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMP
FEEFEKLLTGSDVLDFFQKHFPDSIPLIGAQALAHDYFLLPAQPMISIKCSSFHFKSHCV
LMGDAAHAIVPFFGQGMNAGFEDCLVFDELMEKFNNDLSICLPEFSRFRIPDDHAISDLS
MYNYIEMRAHVNSRWFIFQKNIERVLHCIMPSTFIPLYTMVTFSRIRYHEAVLRWHWQKK
VINRGLFFFGSLIAIGGYYLLVHYMSLRPLDYLRRPWNWITYFQKAGPRSLITPGNH
Download sequence
Identical sequences G1STL6
XP_008266447.1.1745 ENSOCUP00000006661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]