SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006887 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006887
Domain Number 1 Region: 891-1072
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.57e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0055
Further Details:      
 
Domain Number 2 Region: 1047-1168
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.37e-34
Family Ypt/Rab-GAP domain of gyp1p 0.0039
Further Details:      
 
Domain Number 3 Region: 186-214,304-433
Classification Level Classification E-value
Superfamily PH domain-like 3.31e-28
Family Phosphotyrosine-binding domain (PTB) 0.005
Further Details:      
 
Domain Number 4 Region: 106-178
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000998
Family Phosphotyrosine-binding domain (PTB) 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000006887
Domain Number - Region: 428-489
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0876
Family Recombination protein RecR 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006887   Gene: ENSOCUG00000007964   Transcript: ENSOCUT00000007969
Sequence length 1297
Comment pep:known_by_projection chromosome:OryCun2.0:8:76854063:77070081:-1 gene:ENSOCUG00000007964 transcript:ENSOCUT00000007969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSRTPWSPRRARQRSRAPGSRETSSSGCGTWEGRAWTAGPRCPCCPGSWPRSAGAARS
PRRAAAAGRPPRAKCSWCLARPSCAASPAPGAGAAGGAGPSTVQPNPAVFIFEHRAQHIA
RFIHNSHDLTYFAYLIKAQPDDPESQMACHVFRATDPNQVPDVISSIRQLSKAAMKEDAK
PSKDTEDAFYNSQKFEVLYCGKVTVSHKKAPSSLIDDCIEKFSLHEQQRLRLQSDPSEDL
VTPEAEVPGAPRDTLQEEIEAEGDADTHPGLPAAPSQPAPPTSRLCFPERILEDSTFDEQ
QEFRSRCSSVTGVLQKKVHESGQIAQPRRRHASAPSHVQPSDSQKNRTMLFQVGRFEINL
ISPDTKSVVLEKNFKDISSCSQGIKHVDHFGFICREAAEPGLSQYICYVFQCASESLVDE
VMLTLKQAFSTAAALQSAKTQIQLCEACPMHSLHKLCERIEGLYPPRAKLVIQRHLSSLS
DNEQADIFERVQKMKPVSDQEENELVILHLRQLCEAKQKTHTHIGEGPSISSNGEKPGAE
QQEYRTISNSTIPENATSSGRFKLDILKNKAKRSLTSSLENIFSRGANRMRGRLGSVDSF
ERSNSLASEKDCSPGDSPPGTPPASPLSSGWHTFPEEDSDSPQFRRRAHTFSHPPSSTKR
KLNLQEGRAPGVRSPLLRQGSSEQCSILSSVRRIQKESNSSSSLPSLHTSFSAPSFTAPS
FLKSFYQNSGRLSPQYEHEISDGEGRKRTSSTCSNESLNAGGTPVTPRRISWRQRIFLRV
ASPVNRSPSAMQQQDGLDRNELLPLSPLTPTMEEEPLVIFLSGEDDPEKAEERKKSKELK
SLWKKAIHQQILLLRMEKENQKLEARRDELQSRKVKLDYEEVGVYQKDVLITWDKKLLNC
RAKIRSDMEDIHTSLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPDTSYKELLKQLT
AQQHAILVDLGRTFPTHPYFSVQLGAGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLL
HMSEEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENEISP
SLYAAPWFLTLFASQFPLGFVARVFDIIFLQGTEVIFKVALSLLSSQESLIMECENFENI
VEFLKNTLPDMNTSEMEKIITQVFEMDISKQLHAYEVEYHVLQDELQESYACEDSEPLEK
LERANSQLKRQNMDLLEKLQVAHAKIQALESNLENLLTRETKMKTLIRTLEQEKMAYQKT
VEHIRRLVPADALPNCEVLLKDLNCNPNNKAKTGNKP
Download sequence
Identical sequences G1SU69
ENSOCUP00000006887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]