SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006947 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006947
Domain Number 1 Region: 608-882
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.33e-108
Family PDEase 0.000000159
Further Details:      
 
Domain Number 2 Region: 199-398
Classification Level Classification E-value
Superfamily GAF domain-like 1.05e-46
Family GAF domain 0.0001
Further Details:      
 
Domain Number 3 Region: 382-584
Classification Level Classification E-value
Superfamily GAF domain-like 1.98e-42
Family GAF domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006947   Gene: ENSOCUG00000008038   Transcript: ENSOCUT00000008038
Sequence length 882
Comment pep:known_by_projection chromosome:OryCun2.0:7:117337966:117740469:-1 gene:ENSOCUG00000008038 transcript:ENSOCUT00000008038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAAHLDFGEVETFLDRHPELFEDYLMRKGKQEMVEKWLQRHSQCQEALGPRPAPAGTSS
TVHGGGRDGSGVGGGPGPCGSASSQPTSGGGDGGGVPLSPSWASGSRVDGSLQRRASQKE
LRKSFARSKAIHVNRTYDEQVTSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRV
NLPQYPPTAIDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSL
FLVEGAAAGKKSLVSKFFDVHAGTPLLPCSSTENSNEVQVPWGKGIIGYVGEHGETVNIP
DAYQDRRFNDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAPFTEDDEKVMQ
MYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKC
ERCSVLLLEDIDSPVVKFTKSFELLSPKCSADAENSFKESLEKSSYSDWLINNSVAELVA
STGLPVNISDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFD
DADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANI
PLVSELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRM
VLYHNWRHAFNVCQLMFAMLTTAGFQEILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSG
SALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLY
FERRTEFFELVSRGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFE
QGDRERSELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQ
Download sequence
Identical sequences G1SUC2
9986.ENSOCUP00000006947 ENSOCUP00000006947 ENSOCUP00000006947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]