SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000007233 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000007233
Domain Number 1 Region: 32-143
Classification Level Classification E-value
Superfamily PH domain-like 8.72e-40
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000000765
Further Details:      
 
Domain Number 2 Region: 209-311
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 3.01e-35
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000564
Further Details:      
 
Domain Number 3 Region: 389-499
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 3.14e-24
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000007233   Gene: ENSOCUG00000008373   Transcript: ENSOCUT00000008373
Sequence length 512
Comment pep:known_by_projection chromosome:OryCun2.0:7:20811155:20895271:1 gene:ENSOCUG00000008373 transcript:ENSOCUT00000008373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGQQQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWS
KKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVA
LNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGSQ
VNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDM
CGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQGPPQWSAPPPPPPSRAGPPPPPP
PPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPGVGVPPPPPNRMYPPPPPALPS
SAPTGPPPPPPPPPLSGALAPPPPPPPPPPGPPPPPGLPSDGDHQVPAPAGSKAALLDQI
REGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALME
VMQKRSKAIHSSDEDDEEDDEEDFEDDDEWED
Download sequence
Identical sequences G1SV10
ENSOCUP00000007233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]