SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000007663 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000007663
Domain Number 1 Region: 6-266
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.69e-91
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000656
Further Details:      
 
Domain Number 2 Region: 267-466
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.31e-61
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000158
Further Details:      
 
Domain Number 3 Region: 605-768
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 6.67e-39
Family AlaX-like 0.035
Further Details:      
 
Domain Number 4 Region: 523-601
Classification Level Classification E-value
Superfamily Translation proteins 8.7e-16
Family AlaX-M N-terminal domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000007663   Gene: ENSOCUG00000008872   Transcript: ENSOCUT00000008876
Sequence length 991
Comment pep:known_by_projection chromosome:OryCun2.0:5:29194437:29213792:1 gene:ENSOCUG00000008872 transcript:ENSOCUT00000008876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSFLTASEIRQRFIDFFKRNEHTYVHSSGTIPLDDPTLLFANAGMNQFKPIFLNTIDPT
HPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALE
LLTQEFGIPIERLYVTYFGXXXXXXXXXXXXXXQIWQNLGAYLPALCSLDDTKILPGNMK
DNFWEMGDTGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNRETDGVLKP
LPKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGAEDVDGID
MAYRVLADHARTITVALADGGRPDNTGRGYVLRRILRRAVRYSHEKLNASRGFFATLVDV
VVQSLGDAFPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDCKTIPGDTAW
LLYDTYGFPVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIEE
LRAKGLEATDDSPKYNYQADSSGSYVFESTVATVLALRREKMFVEEVSTGQECGVVLDKT
CFYAEQGGQIYDEGYLVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTVYGSLRVGDQVRLF
IDEPRRRPVMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKA
EEIANEMIAAAKPVYTQDCALAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLEDPSG
PAGSLTSVEFCGGTHLRNSSHAGDFVIVTEEAIAKGIRRIVAVTGAEAQKALRKAESLKK
SLSVMEAKVKAQTAPNKDVQKEIADLGEALAAAVIPQWQKDELRETLKSLKKIMDDLDRA
SKADVQKRVLEKTKQLIDSNPNQPLVILEMESGASAKATQGQGCGLTPVLPQALNEALKL
FKTHSPQTSAMLFTVDNEAGKITCLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDMS
AQATGKNVGCLQEALQLATSFAQLRLGDVKN
Download sequence
Identical sequences G1SW24
ENSOCUP00000007663 ENSOCUP00000007663 9986.ENSOCUP00000007663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]