SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000007841 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000007841
Domain Number 1 Region: 39-332,515-576
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.67e-92
Family FAD-linked reductases, N-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 334-516
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.55e-56
Family GMC oxidoreductases 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000007841   Gene: ENSOCUG00000009074   Transcript: ENSOCUT00000009078
Sequence length 595
Comment pep:known_by_projection chromosome:OryCun2.0:9:20783229:20789283:-1 gene:ENSOCUG00000009074 transcript:ENSOCUT00000009078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWVLRSWRLVRPGLDAALVRGTLGRPQGSRAVGSAGASTEFSYVVVGAGSAGCVLAARL
TEDPAERVLLLEAGPRDVWAGSKRLSWKIHMPAALVANLCDDRYNWCYHTEPQPGLDGRV
LYWPRGRVWGGSSSLNAMVYVRGHADDYDRWQRQGAQGWDYAHCLPYFRKAQAHELGADT
YRGGDGPLRVSRGKTNHPLHLAFLEAAQQAGYPFTEDMNGFQQEGFGWMDMTIHEGKRWS
TACAYLHPALSRPNLQAEARTLVRRVLFEGTRAVGVEYVKNGQSHVARASKEVILSGGAI
NSPQLLMLSGVGPADDLQRLGIPVVCHLPGVGQNLQDHLEVYVQQACTRPITLHSAQKPL
RKICIGLQWLWKFTGDGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPTQQEA
YQVHVGTMRGTSVGWLRLKSANPQDHPVIQPNYLSTEADIKDLRLCVKLTREIFAQDALA
RFRGEELQPGSHVQSDGEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVDN
LRVVDASIMPSVVSGNLNAPTIMIAEKAADIIKGRPALWDKDVPVYRPKTLATQR
Download sequence
Identical sequences G1SWH6
ENSOCUP00000007841 XP_017199371.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]