SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000007962 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000007962
Domain Number 1 Region: 463-764
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.58e-103
Family PDEase 0.00000059
Further Details:      
 
Domain Number 2 Region: 247-438
Classification Level Classification E-value
Superfamily GAF domain-like 6.54e-48
Family GAF domain 0.000029
Further Details:      
 
Domain Number 3 Region: 90-239
Classification Level Classification E-value
Superfamily GAF domain-like 4.14e-20
Family GAF domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000007962   Gene: ENSOCUG00000009218   Transcript: ENSOCUT00000009223
Sequence length 781
Comment pep:known_by_projection chromosome:OryCun2.0:12:154530187:154809897:-1 gene:ENSOCUG00000009218 transcript:ENSOCUT00000009223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIEERKSQHFTGLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKNNKPEDESTP
KEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGEC
NNSLCVFTPPGLKEGRPRLVPAGPITQGTTISAYVAKSRKTLLVEDILGDERFPRGTGLE
SGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWASVAIHQVQVC
RGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELY
SDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYT
GYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYHR
IRHSECIYRVTMEKLSYHSICTAEEWQGLMRFTLPSRLCKEVELFHFDIGPFENMWPGIF
VYMIHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNSYGLFTD
LERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNI
FSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMM
TACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKRDEVPQGQLGFY
NAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETALWISSPATAPDPCPGKTE
D
Download sequence
Identical sequences G1SWT1
XP_008261980.1.1745 ENSOCUP00000007962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]