SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008028 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008028
Domain Number 1 Region: 445-469
Classification Level Classification E-value
Superfamily Notch domain 0.0000654
Family Notch domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000008028
Domain Number - Region: 968-1041
Classification Level Classification E-value
Superfamily EF-hand 0.00223
Family Parvalbumin 0.059
Further Details:      
 
Domain Number - Region: 508-535
Classification Level Classification E-value
Superfamily Notch domain 0.00471
Family Notch domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008028   Gene: ENSOCUG00000009299   Transcript: ENSOCUT00000009301
Sequence length 1201
Comment pep:known_by_projection chromosome:OryCun2.0:4:80964669:81149874:-1 gene:ENSOCUG00000009299 transcript:ENSOCUT00000009301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLKLLQRQTYTCLSHRYGLYVCFVGVVVTIVSAFQFGEVVLEWSRDQYHVLFDSYRDNI
AGKSFQNRLCLPMPIDVVYTWVNGTDLELLKELQQVREQMEEEQKAMRELLGKNTTEPTK
KSEKQLECLLTHCIKVPMLVLDPALPANSTLKDLPSLYPSFHSASDIFNVAKPKNPSTNV
SVVVFDSTKDVEDAYTGLSKGNSKQTVWRGYLTTDKEVPGLVLMQDLVFLSGFPPTFKET
SQLKTKLPENLSSKIKLLQLYSEASVALLKLNNPKDFQELNKQTKKNMTIDGKELTISPA
YLLWDLSAISQSKQDEDISASRFEDNEELRYSLRSIERHAPWVRNIFIVTNGQIPSWLNL
DNPRVTIVTHQDVFRNLSHLPTFSSPAIESHIHRIEGLSQKFIYLNDDVMFGKDVWPDDF
YSHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNNSACDWDGGDCSGNSGGHRYAAG
GGGTGSLGVGQPWQFGGGINSVSYCNQGCANSWLADKFCDQACNVLSCGFDAGDCGQDHF
HELYKVTLLPNQTHYILPKGECLPYFSFAEIAKRGVEGAYSDNPIIRHASVANKWKTIHL
ILHSGMNATTIRFNLTFQNAHDEEFKIQLTVEVDTREGPKLNSTTQKSYENLVSPVTLLP
EAEVLFEDIPEEKRFPKVKRYPNTTERVQEEVKIPVVNISLLPKEIQLKLNHLDLQLEHG
DITLKGYNLSKSALLRSFLMNSQDAKIKISPTITDKTNDSVEAPPLAKQSHEGILPNSLG
VSQQLQRSALPAGTVKANGHYQSQTLVLGTKGRFRSETQTHKVVGGSINFSSLAVPLENH
EMEEKITGEEEETNRMKERTKNHIGANELLPRRKLQYYTESYPGFLPWEKRKFFQDLLHE
EESLKTQLAYFTDSKYTGRQLQDTFADSLRYVNKILNSKFGFTSRKVPAHMPHMIDRIVM
QELQDMFPEEFDKTSFHKVRHSEDMQFAFSYFYYLMSAVQPLNISQVFDEVDTDQSGVLS
DREIRTLATRIHDLPLSLQDLTSLEHMLINCSKMLPANITQLNNIPPTQEAYYDPNLPPV
TKSLVTNCKPVTDKIHKAYKDKNKYRFEIMGEEEIAFKMIRTNVSHVVGQLDDIRKNPRK
FVCLNDNIDHNHKDAQTVKAVLRDFYESMFPIPSQFELPREYRNRFLHMHELQEWRAYLT
Y
Download sequence
Identical sequences G1SWY5
ENSOCUP00000008028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]