SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008127 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008127
Domain Number 1 Region: 526-847
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.05e-109
Family PDEase 0.0000000000136
Further Details:      
 
Domain Number 2 Region: 137-331
Classification Level Classification E-value
Superfamily GAF domain-like 1.09e-44
Family GAF domain 0.0000786
Further Details:      
 
Domain Number 3 Region: 317-521
Classification Level Classification E-value
Superfamily GAF domain-like 4.36e-38
Family GAF domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008127   Gene: ENSOCUG00000009417   Transcript: ENSOCUT00000009422
Sequence length 865
Comment pep:known_by_projection chromosome:OryCun2.0:15:94659473:94814328:-1 gene:ENSOCUG00000009417 transcript:ENSOCUT00000009422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPAGPSPGRPQQQRDTDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVHTIPVCKE
GVRGHPESCSCPLQQTPRADSSAPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLSDSEK
KEQMPLTPPRFEHDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLISADRYSLFLV
CEDSSNDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAALGEPLNIKDAYEDPR
FNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFC
GIVLHNAQLYETSLLENRRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIF
IVDEDCSDSFSSVFHMECEELEKSSDTLTRERDSNKINYMYAQYVKNTMEPLNIPDVSKD
KRFPWTSENTGNINQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTGKVKPFNRNDEQ
FLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETRELQSLAAAVVPS
AQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWILSVKKNYRKNV
AYHNWRHAFNTAQCMFAALKSGKIQNKLTDLEILALLIAALSHDLDHRGVNNSYIQRSEH
PLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTALKIIKQAILATDLALYIK
RRGEFFELIRKNQFDVEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAELVATEFFDQG
DRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCFPLLDGCRKNR
QKWQALAEQQEKMLINGESNQAKRN
Download sequence
Identical sequences G1SX67
9986.ENSOCUP00000008127 ENSOCUP00000008127 XP_002717273.1.1745 ENSOCUP00000008127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]