SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008818 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008818
Domain Number 1 Region: 528-560,637-710
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000804
Family Anti-sigma factor antagonist SpoIIaa 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008818   Gene: ENSOCUG00000010227   Transcript: ENSOCUT00000010228
Sequence length 746
Comment pep:known chromosome:OryCun2.0:7:39670311:39702872:-1 gene:ENSOCUG00000010227 transcript:ENSOCUT00000010228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHAEDSEALAAAQRYCVERPIFSHPVLQERLHKKDKVADSIGDKLKQAFTCTPKKIRNI
IYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPV
IMYCFLGTSRHISIGPFAVISLMIGGVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAM
SVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGI
FSVVYSTVAVLQNIKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMG
TGISAGFNLKESYSVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKT
LANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLM
ILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFADLPFFWRTSKIELTIWLTTFVSSL
FLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEEVKEIPGIKIFQI
NAPIYYANSDLYSNALKRKTGVNPAVIMGARRKAMRKYAKEVGNANIANATVAKVWQDAE
VDGENAPKPEEEEEEVKYPPIVVRSTFPEELQRFMPPGDGVHTIILDFTQVNFIDSVGVK
TVAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALKELLFYSIHDAVLGSQVREA
MAEQEALAAPAQEDMEPNATPTTPEA
Download sequence
Identical sequences G1SYW0
ENSOCUP00000008818 ENSOCUP00000008818 9986.ENSOCUP00000008818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]