SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008994 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008994
Domain Number 1 Region: 254-450
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.73e-42
Family PDEase 0.0000989
Further Details:      
 
Domain Number 2 Region: 23-211
Classification Level Classification E-value
Superfamily GAF domain-like 1.91e-25
Family GAF domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008994   Gene: ENSOCUG00000010439   Transcript: ENSOCUT00000010443
Sequence length 592
Comment pep:known_by_projection chromosome:OryCun2.0:16:19782872:19791689:-1 gene:ENSOCUG00000010439 transcript:ENSOCUT00000010443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLQWSANKVFEKLTDIERQFHAFYTVRAYLNCDRYSVGLLDMAKEKAVLMGEAQPYSGPC
TPDSQEIVFYKVINYILHGKEDIKVIPTPPADHWALASGLPTYMAESGFICNIMNTFTDK
MFKFQDGPLDDSGWVIKHVLSMPIINKKEEIVGVATFYNRKDGKPFDEQDEVIMESLMQF
LGWLVLNTDTYDKMNKLENHKDIAQDMVLYHVRCDKDEIQAAPSLPTRDRLGKEPTDCEE
EELGLILKEELPGPSKFDIYEFHFSDLECTELELVKCGIQMYYELGVVRKFQIPQEVGGV
WSGPQSPRRITYHNWHHSFNVTQTMSMLLMMGKLKSYYTLEDFTMETAGLCHDIDHRSTN
NLHHMKSQNPLAKLQGSSILERYYLEFRKFLLSEEVCVLTSNLNLQQHEHVIHLMDIAII
ATDLALYFKKRRTFQVADETKNNQDKSWVEYMSLETTWKEIVMSSLTHNPPTSPLGLCWG
LDVLLIASPSPTALSAKGRPAVGQAGQACKGLGWEAPVGGLVMAEFSLFQEEILPMFDRL
QNNRKEWKTLADEYEAKVKALGNPSHKSEGRGSPGEGGTEICNGGPAPKSST
Download sequence
Identical sequences G1SZA5
ENSOCUP00000008994 9986.ENSOCUP00000008994 ENSOCUP00000008994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]