SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000009077 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000009077
Domain Number 1 Region: 484-842
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.37e-114
Family PDEase 0.000000224
Further Details:      
 
Domain Number 2 Region: 238-283,310-460
Classification Level Classification E-value
Superfamily GAF domain-like 5.89e-31
Family GAF domain 0.00085
Further Details:      
 
Domain Number 3 Region: 57-252
Classification Level Classification E-value
Superfamily GAF domain-like 2.94e-28
Family GAF domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000009077   Gene: ENSOCUG00000010528   Transcript: ENSOCUT00000010532
Sequence length 861
Comment pep:known_by_projection chromosome:OryCun2.0:18:41301640:41361058:1 gene:ENSOCUG00000010528 transcript:ENSOCUT00000010532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDLSRDAVEKYLEQNPQFAKEYFDKRLRAEALGEIFKNSQAAVPASMSFAELTQVEEAA
VCLELLLTVQEEAGGAELAAHRALQRLAQLLCAERCSLFMCRARNGTPEVASRLLDVTPT
SKLEDNLVAPEREVVFPLDIGIVGWVAHTKKALNVPDVRKNSHFSDFMDKQTGYVTRNLL
ATPVVMGKEVLAVVMAVNKVNAPEFSKQDEEVFSKYINLVSVILKLHHTNYLYSIESRRS
QILMWSANKVFEELTDVERQFHKALYTVRTYLNCERYSIGLLDMTKEKEFYDEWPIKLGE
VEPYKGPKTPDGREIIFYKIIDYILHGKEEIKVIPTPPTDHWTLVSGLPTYVAENGFICN
MLNAPADEYFTFQKGPVDETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEHDEH
ITETLTQFLGWSLLNTDTYEKMNKLENRKDIAQEMLMNHTKATLEEIESILKFKEKLNKD
AIEDCEEKQLIKILKEDLPDPKEVELYEFRFSDFPITEHGLIKCGIRLFFEINVVEKFKV
PVEVLTRWMYTVRKGYRAVTYHNWRHGFNVGQTMFTLLMTGRLKKYFTDLEAFAMLAAAF
CHDIDHRGTNNLYQMKSTSPLAKLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQFET
VIHLFEVAIIATDLALYFKKRTMFQKIVDACEQMKTEEEAIKYVTIDPTKKEIIMAMMMT
ACDLSAITKPWEVQSQVALMVANEFWEQGDLERTVLQQQPIPMMDRNKKDELPKLQVGFI
DFVCTFVYKEFSRFHEEITPMLNGLQNNRVEWKTLADEYDAKMKVIEEEEKKQEEGNSVQ
KVAEVSGGGSEDKKSKTCLML
Download sequence
Identical sequences G1SZH7
XP_017203912.1.1745 ENSOCUP00000009077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]