SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000009250 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000009250
Domain Number 1 Region: 312-594
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.81e-91
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000126
Further Details:      
 
Domain Number 2 Region: 136-309
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.09e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00013
Further Details:      
 
Domain Number 3 Region: 596-702
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.42e-27
Family Anticodon-binding domain of Class II aaRS 0.0011
Further Details:      
 
Domain Number 4 Region: 79-134
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000654
Family TGS domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000009250   Gene: ENSOCUG00000010740   Transcript: ENSOCUT00000010740
Sequence length 713
Comment pep:known_by_projection chromosome:OryCun2.0:17:84358354:84408481:1 gene:ENSOCUG00000010740 transcript:ENSOCUT00000010740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVDASPSSCLFQPPSQSQDEDTDKKKMKESGPDSEVQRRPHFIKERLELFQALKEDSQAL
LPVGEQEDAGSALTVRVAGGETVEGARGRTTPYQVAAAISRELAESAVVAKVDGELWDLD
RPLQGDCTLELLTFHSEEAQAVYWHSSAHVLGEAMELYYGGHLCYGPPIENGFYYDMFIE
DRAVSSTELPALENMCKAIIKERQPFERLEVSKEVLLEMFKYNKFKCRILNEKVDTPTTT
VYRCGPLVDLCKGPHVRHTGKIKAIKIFKNSSTYWEGSPEMETLQRIYGISFPDNKMMKT
WEQVQEEAKNRDHRKIGKEQELFFFHDVSPGSCFFLPRGAFVYSTLMDLIREEYHKRDFL
EVLSPNVYNSKLWETSGHWQHYSENMFTFRVEKETFALKPMNCPGHCLMFAHRPRSWREM
PVRFADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTVEQIEEEIKGCLQFLQSVYSTF
GFTFQLNLSTRPENFLGESEMWAEAEKQLQNSLVEFGKPWKLNPGDGAFYGPKIDIKIKD
AIGRYHQCATIQLDFQLPIRFNLTYVSKDGDDKKRPVIIHRATLGSVERMVAILSENCGG
KWPLWLSPRQVMVIPVGPTCEKYALQVYNEFFEEGFMADVDLDHSCTLNKKIRNAQLAQY
NFILVVGEKEMANNAVNVRTRDNKIHGEISVISAIEKLKNLKKCRTLNAEEEF
Download sequence
Identical sequences G1SZW3
ENSOCUP00000009250 ENSOCUP00000009250 9986.ENSOCUP00000009250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]