SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000009500 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000009500
Domain Number 1 Region: 22-358
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.96e-107
Family Phosphofructokinase 0.000000302
Further Details:      
 
Domain Number 2 Region: 349-772
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.44e-106
Family Phosphofructokinase 0.000006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000009500   Gene: ENSOCUG00000011039   Transcript: ENSOCUT00000011042
Sequence length 791
Comment pep:known scaffold:OryCun2.0:GL018707:2754451:2823265:1 gene:ENSOCUG00000011039 transcript:ENSOCUT00000011042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNKVSASPRGSYRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFI
YEGYQGMVDGGSNIVEANWESVSSILQVGGTIIGSARCKAFRTREGRLKAACNLIHRGIT
NLCVIGGDGSLTGANIFRMEWSGLLEELAQDGKIDNEAVQKYAYLNVVGMVGSIDNDFCG
TDMTIGTDSALHRIIEVIDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWEEQMCVKLSENRAQKKRLNIIIVAEGAIDTLNRPITSEKIKELVVTQLGYDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVLALLEATPETPACVVSLSGNHAVRLPLVEC
VQMTQEVQKAMDERRFKDAVQLRGRSFENNLNTYKRLAIKLPDDKIQKSNCNVAVINVGA
PAAGMNAAVRSAVRVGIADGHKMFAVYDGFDGFAKGQIKEIRWGDVGGWTGQGGSILGTK
RILPGKYLEEIATQIRTHNINAILIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVS
NNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA
DAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGRG
VFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMQWITTKLKESPGKGKRFVSDDSICVL
GISKRNVLFQPVAELKNETDFEHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEPVR
HRGGPEEPAAI
Download sequence
Identical sequences G1T0H8
ENSOCUP00000009500 ENSOCUP00000009500 9986.ENSOCUP00000009500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]