SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000009849 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000009849
Domain Number 1 Region: 83-194
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.42e-32
Family Transglutaminase, two C-terminal domains 0.00000321
Further Details:      
 
Domain Number 2 Region: 196-293
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.62e-28
Family Transglutaminase, two C-terminal domains 0.00000425
Further Details:      
 
Domain Number 3 Region: 2-68
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.000000000000662
Family Transglutaminase core 0.0000392
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000009849   Gene: ENSOCUG00000011452   Transcript: ENSOCUT00000011451
Sequence length 298
Comment pep:known_by_projection scaffold:OryCun2.0:GL018715:4958:40479:1 gene:ENSOCUG00000011452 transcript:ENSOCUT00000011451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVNSDIIYITAKKDGSHVVQAVDTTSIGKLIVTKQIGGDGMTDITDAYKFQEGQEEERLA
LETALMYGAKKALSTEGVIKSRSDVDMNFEVENAVLGKDLKLTVTFQNSSPNRYTVSAYL
SGNVTFYTGVSKVEFKNESFRVVLEPLSYKKEEVWIRAGEYMGQLLEQASLHFFVTARVN
ETKDVLAKQKSVVLTVPKVVIKVRGTPEVGSDMVVTVEFTNPLQETLQNVWIHLDGPGVI
RPKRKLFREIRPNSTVQWEEVCRPWVPGPRKLIASMTSDSLRHVYGELNLEIRRRPSM
Download sequence
Identical sequences G1T1B8
ENSOCUP00000009849 9986.ENSOCUP00000009849 ENSOCUP00000009849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]