SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000010226 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000010226
Domain Number 1 Region: 64-186
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.81e-37
Family Cold shock DNA-binding domain-like 0.000000706
Further Details:      
 
Domain Number 2 Region: 7-56
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000000000034
Family ECR1 N-terminal domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000010226   Gene: ENSOCUG00000011898   Transcript: ENSOCUT00000011898
Sequence length 196
Comment pep:novel chromosome:OryCun2.0:18:45647217:45655814:-1 gene:ENSOCUG00000011898 transcript:ENSOCUT00000011898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPVRYCIPGERLCNLEEGSPGSGTYTRHGYIFSSLAGCLTKTSENGALPVVSVMREAE
SQLLPDVGSIVTCKVSSINSRFAKVHILYVGSTPLKNSFRGTIRRKEDVRATEKDKVEIY
KSFRPGDIVLAKVISLGDAQSNYLLTTAENELGVVVAHSESGVQMVPISWCEMQCPKTHT
KEFRKVARVQPEFLQT
Download sequence
Identical sequences G1T271
ENSOCUP00000010226 ENSOCUP00000010226 9986.ENSOCUP00000010226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]