SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011006 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011006
Domain Number 1 Region: 43-238
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 2.22e-77
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.0000114
Further Details:      
 
Domain Number 2 Region: 319-475
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 1.57e-65
Family C-terminal domain of adenylylcyclase associated protein 0.000000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011006   Gene: ENSOCUG00000012790   Transcript: ENSOCUT00000012790
Sequence length 475
Comment pep:known chromosome:OryCun2.0:13:126465133:126477214:-1 gene:ENSOCUG00000012790 transcript:ENSOCUT00000012790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADMQNLVERLERAVGRLEAVSHTSDMHRGYGDSPSKAGAALYVQAFDSLLAGPVAEYLK
NSKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAGNKLSDLLAPISEQIQEVITFRE
KNRGSKLFNHLSAVSESIQALGWVAVAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHV
DWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSGPPPPPPGPPPP
PVPTSSVSDDSASRSALFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPF
SAPKPQTSPSPKPATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQVAYIYKCVNTT
LQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHTYL
SKNSLDCEIVSAKSSEMNILIPTEGGDFNEFPVPEQFKTVWNGHKLVTTVTEIAG
Download sequence
Identical sequences G1T432
ENSOCUP00000011006 9986.ENSOCUP00000011006 ENSOCUP00000011006 XP_008263734.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]