SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011274 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011274
Domain Number 1 Region: 21-143
Classification Level Classification E-value
Superfamily Lysozyme-like 2.95e-36
Family C-type lysozyme 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011274   Gene: ENSOCUG00000013102   Transcript: ENSOCUT00000013093
Sequence length 145
Comment pep:known_by_projection chromosome:OryCun2.0:9:1818326:1828499:1 gene:ENSOCUG00000013102 transcript:ENSOCUT00000013093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKASVVFSLLGFLVAPSAAYVLGRCTVAKKLREGGLDYFEGYSLENWVCLAYFESKFNPT
AVYENAPDGYAGFGLFQIRNDGWCDHGKNLCRMSCSEMLNPNLKKTIECVKIIVKGKEGM
GAWPTWSQNCQLSDTLGRWLDGCKM
Download sequence
Identical sequences G1T4Q1
ENSOCUP00000011274 ENSOCUP00000011274 9986.ENSOCUP00000011274 XP_002713109.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]