SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011919 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011919
Domain Number 1 Region: 496-831
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 9.42e-111
Family PDEase 0.000000281
Further Details:      
 
Domain Number 2 Region: 56-250
Classification Level Classification E-value
Superfamily GAF domain-like 3.73e-31
Family GAF domain 0.00043
Further Details:      
 
Domain Number 3 Region: 237-289,321-458
Classification Level Classification E-value
Superfamily GAF domain-like 6.98e-30
Family GAF domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011919   Gene: ENSOCUG00000013850   Transcript: ENSOCUT00000013857
Sequence length 859
Comment pep:known_by_projection chromosome:OryCun2.0:3:31654181:31719600:-1 gene:ENSOCUG00000013850 transcript:ENSOCUT00000013857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEVTAEEVEKFLDSNIGFAKQYCNHRYRAQVLSDLLGAKEAAVDFSSYHTLSSVEESEV
IFDLLRDFQENLQAEKCTFNVMKKLCFLLQADRMSLFMYRTRNGVAELATRLFNVHKDAA
LEDCLVVPDSEIVFPLDMGVVGHVAHSKKLANVPNTEEDEHFCDFVDNLTEYQTKNILAS
PIMNGKDVVAVIMAVNKVDGTHFSKRDEEILLKYLNFANLIMKVFHLSYLHNCETRRGQI
LLWSGSKVFEELTDIERQFHKALYTVRAFLNCDRYSVGLLDMTKQKEFFDVWPVLMGEVP
PYSGPRTPDGREINFYKVIDYILHGKEDIKVIPNPPPDHWALVSGLPTYVAQNGLICNIM
NAPAEDFFAFQKEPLDESGWTIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEMDETLM
ESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQKILKTREVYGKEPW
ECEEEELAEILQGELPDAEKYEINKFHFSDLPLTELELVKCGIQMYYELKVVEKFHIPQE
ALVRFMYSLSKGYRRITYHNWRHGFNVGQTMFSLLVTGKLKRYFTDLEALAMVTAAFCHD
IDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKTLLRDESLNIFQNLNRRQHEHAIH
MMDIAIIATDLALYFKKRTMFQKIVDQSKTYENAQEWTQYMMLEQTRKEIVMAMMMTACD
LSAITKPWEVQSKVALLVAAEFWEQGDLERTVLQQNPIPMMDRNKADELPKLQVGFIDFV
CTFVYKEFSRFHEEITPMLDGITNNRKEWKALADEYDAKVKTLEEEKQKQQAKQGASGNQ
PAGNPTPGGAPASKSCCIQ
Download sequence
Identical sequences G1T694
9986.ENSOCUP00000011919 ENSOCUP00000011919 ENSOCUP00000011919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]