SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011927 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011927
Domain Number 1 Region: 572-602,641-719
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.91e-16
Family Anti-sigma factor antagonist SpoIIaa 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011927   Gene: ENSOCUG00000013871   Transcript: ENSOCUT00000013867
Sequence length 739
Comment pep:known_by_projection chromosome:OryCun2.0:3:31755839:31763212:1 gene:ENSOCUG00000013871 transcript:ENSOCUT00000013867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSESKEQHDMSLRDSVEGIDQLPSGIHLEPQKESSTDFRQFEKSDHCRPYPRIRMEPQE
KSNANFKQFVIKKLQKSCRCNRTKAKHMIFDFLPVLRWLPKYDIKKNILGDVMSGLIVGI
LLVPQSIAYSLLAGQKPIYGLYTSFFASIIYFLFGTSRHISVGIFGVLCLMIGEVVDREL
HKAGYDTAQIDPSLGMVSNGTTLSNHTTDTICDKYCYAIKVGSTVTFMAGVYQVVMGFFQ
VGFVSVYLSDALLSGFVTGASFTILTSQVKYLLGLSLPRSHGVGSLITTWIHIFRNIHKT
NICDLITSLLCLLVLVPTKELNEHFKTKLKAPIPTELIVVVAATLASHFGKLNEKYNSSI
AGHIPTNFMPPKAPDWNLIPSVAVDAIAISIIGFAITVSLSEMFAKKHGYTVKANQEMYA
IGFCNIIPSFFNCITTSAALAKSLVKESTGCQTQISGLVTALVLLLILLVIAPLFSSLQK
SVLGVITIVNLRGAFLKFRDLPKMWRVSRMDTVIWFVTMLSSALISTEIGLLVGVCFSMF
CVILRTQKPEVSLLGLVEESEVFECMSAYKNLQTKPGIRIFRFVAPLYYINKECFKSALY
KKTINPVLVKAAQRKAAKRKMREETLTLGRVQDEVSVHLSHDPLELRTIVIDCSAIQFLD
TAGIGALKEVRRDYEAIGIQVLLAQCNPSVRDSLARGEYCKKDEENLLFYSVYEAVAFAV
EAQKQEATWVPNGLSPASN
Download sequence
Identical sequences G1T6A1
ENSOCUP00000021256 9986.ENSOCUP00000011927 ENSOCUP00000011927 XP_017196673.1.1745 XP_017196674.1.1745 XP_017196675.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]