SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011947 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011947
Domain Number 1 Region: 19-147
Classification Level Classification E-value
Superfamily Lysozyme-like 8.31e-55
Family C-type lysozyme 0.000000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011947   Gene: ENSOCUG00000013891   Transcript: ENSOCUT00000013890
Sequence length 148
Comment pep:known chromosome:OryCun2.0:4:48376630:48382989:1 gene:ENSOCUG00000013891 transcript:ENSOCUT00000013890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALLILGLLLLSTTVQGKIYERCELARTLKKLGLDGYKGVSLANWMCLTKWESSYNTQA
TNYNPGDKSTDYGIFQINSRYWCNDGKTPRAVNACHIPCSDLLKDDITQAVACAKRVVSD
PQGIRAWVAWRNHCQSQDLTSYIQGCGV
Download sequence
Identical sequences G1T6B8
XP_002711370.1.1745 ENSOCUP00000011947 ENSOCUP00000011947 9986.ENSOCUP00000011947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]