SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011949 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011949
Domain Number 1 Region: 32-198
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.16e-56
Family G proteins 0.000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011949   Gene: ENSOCUG00000013895   Transcript: ENSOCUT00000013893
Sequence length 227
Comment pep:known_by_projection chromosome:OryCun2.0:4:39540618:39544536:1 gene:ENSOCUG00000013895 transcript:ENSOCUT00000013893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPSTLSHSDNLAMTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEY
QESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETF
ARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAM
NVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN
Download sequence
Identical sequences G1T6C0 H2Q672 W5PLV3
9986.ENSOCUP00000011949 ENSOCUP00000011949 ENSOCUP00000011949 ENSOARP00000011427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]